SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013059 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013059
Domain Number 1 Region: 130-576
Classification Level Classification E-value
Superfamily SNF-like 3.4e-139
Family SNF-like 0.00026
Further Details:      
 
Domain Number 2 Region: 41-81
Classification Level Classification E-value
Superfamily SNF-like 9.55e-17
Family SNF-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013059   Gene: ENSGGOG00000013384   Transcript: ENSGGOT00000013436
Sequence length 629
Comment pep:known_by_projection chromosome:gorGor3.1:3:14853329:14916477:1 gene:ENSGGOG00000013384 transcript:ENSGGOT00000013436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVG
LGNVWRFPYLCYKNGGAGAFLPPLRSDLHLPGSQHPKEYLVVTVERPLVAWGLGIPWPSR
CLLISFAQPAGIGYASIVIVSLLNVYYIVILAWATYYLFQSFQKELPWAHCNHSWNTPHC
MEDTMRKNKSVWITISSTNFTSPVIEFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVC
FFCIWKGVRSTGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYPDITRLEDPQVW
IDAGTQIFFSYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFM
AQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQI
TSLVDLYPSFLRKGYRREIFIAFVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWV
AFFECFVIAWIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLT
YNKTYVYPNWAIGLGWSLALSSMLCVPLVIVIRLCQTEGPFLVRVKYLLTPREPNRWAVE
REGATPYNSRTVMNGALVKPTHIIVETMM
Download sequence
Identical sequences ENSGGOP00000013059 ENSGGOP00000013059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]