SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013070 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013070
Domain Number 1 Region: 127-176
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000589
Family Hairy Orange domain 0.0029
Further Details:      
 
Domain Number 2 Region: 65-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000089
Family HLH, helix-loop-helix DNA-binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013070   Gene: ENSGGOG00000013399   Transcript: ENSGGOT00000013447
Sequence length 248
Comment pep:known_by_projection chromosome:gorGor3.1:1:854297:855316:-1 gene:ENSGGOG00000013399 transcript:ENSGGOT00000013447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKVGSRPGVRGATGGREGRRGTQPVP
DPQSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRR
VQVTAVLSADPAVLGKYRAGFHECLEEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPS
RRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGVTRALPAAPRAGPQGPG
GPWRPWLR
Download sequence
Identical sequences ENSGGOP00000013070 ENSGGOP00000013070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]