SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013095 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013095
Domain Number 1 Region: 268-330
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.78e-19
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 2 Region: 210-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 3 Region: 95-152
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000109
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 148-205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000109
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 5 Region: 23-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000301
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013095   Gene: ENSGGOG00000012348   Transcript: ENSGGOT00000013473
Sequence length 331
Comment pep:known_by_projection chromosome:gorGor3.1:1:176528345:176673106:1 gene:ENSGGOG00000012348 transcript:ENSGGOT00000013473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLTNVILTLWVSCANGQAMKPCEFPEIQHGHLYYENMYRLYFPVAAGKSYSYYCDQNF
VTPSGSYWDYIHCTQDGWSPTVPCLRTCSKSDIEIENGFISESSSIYILNKEIQYKCKPG
YATADGNSSGSITCLQNGWSAQPICIKFCDMPVFENSRAKSNGVRFKLHDTLDYECYNGY
EISYGNTTGSIVCSEDGWSHFPTCYNSSEKCGPPPPISNGGTTSFLLKVYVPQSRVEYQC
QSYYELQGSNYVTCSNGEWSEPPRCIHPCIITEENMNKNNIKLKGRSDRKYYAKTGDTIE
FMCKLGYNANTSILSFQAVCREGIVEYPRCK
Download sequence
Identical sequences ENSGGOP00000013095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]