SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013103 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013103
Domain Number 1 Region: 85-141
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000433
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 23-90
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000418
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013103   Gene: ENSGGOG00000002429   Transcript: ENSGGOT00000013481
Sequence length 143
Comment pep:known_by_projection chromosome:gorGor3.1:1:176694819:176735021:1 gene:ENSGGOG00000002429 transcript:ENSGGOT00000013481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLMVSVILISWISSVGEEGTLCDFPKIHHGFLYDEEDYNPFSQVPTGEVFYYSCEYNFV
SPSKSFWTRITCTEEGWSPTPKCLRMCSFPFVKNGHSESSGLIHLEGDTVQIICNTGYRL
QNNEKNISCVERGWSTPPICSFT
Download sequence
Identical sequences ENSGGOP00000013103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]