SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013105 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013105
Domain Number 1 Region: 298-596
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 3.92e-113
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0000000859
Further Details:      
 
Domain Number 2 Region: 24-295
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-69
Family G proteins 0.0000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013105   Gene: ENSGGOG00000013428   Transcript: ENSGGOT00000013483
Sequence length 640
Comment pep:known_by_projection chromosome:gorGor3.1:1:91606526:91620255:-1 gene:ENSGGOG00000013428 transcript:ENSGGOT00000013483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGERTLHAAVPTPDYPESESIMMAPICLVENQEEQLTVNSKALEILDKISQPVVVVAIVG
LYRTGKSYLMNRLAGKRNGFPLGSTVQSETKGIWMWCVPHPSKPNHTLVLLDTEGLGDVE
KSNPKNDSWIFALAVLLSSSFVYNSMSTINHQALEQLHYVTELAKLIRAKSCPRPDEAED
SSEFASFFPDFIWTVRDFTLELKLDGNPITEDEYLENALKLIPGKTPKIQNSNMPRECIR
HFFRKRKCFVFDRPTNDKQYLNHMDEVPEENLERHFLMQSDNFCSYIFTHAKTKTLREGI
IVTGKRLGTLVVTYVDAINSGAVPCLENAVTALAQLENPAAVQRAADHYSQQIAQQLRLP
TDTLQELLDVHAACEREAIAVFMEHSFKDENHEFQKKLVDTMEKKKGDFVLQNEEASAKY
CQAELKRLSEHLTESILRGIFSVPGGHNLYLEEKKQVERDYKLVPRKGVKANEVLQNFLQ
SQVVVEESILQSDKALTAGEKAIAAERAMKEAAEKEQELLREKQKEQQQMMEAQERSFQE
YMAQMEKKLEEERENLLREHERLLKHKLKVQEEMLKEEFQKKSEQLNEEINQLKEKIEST
KNEQLRLLKILDMASNIMIVTLPGASKLLGVGTKYLGSRI
Download sequence
Identical sequences ENSGGOP00000013105 ENSGGOP00000013105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]