SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013120 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013120
Domain Number 1 Region: 173-371
Classification Level Classification E-value
Superfamily E set domains 3.92e-75
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000141
Further Details:      
 
Domain Number 2 Region: 71-189
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013120   Gene: ENSGGOG00000013455   Transcript: ENSGGOT00000013498
Sequence length 436
Comment pep:known_by_projection chromosome:gorGor3.1:19:45729746:45740315:1 gene:ENSGGOG00000013455 transcript:ENSGGOT00000013498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA
ASPRVLTPTLALTLPP
Download sequence
Identical sequences Q9UNX9
ENSGGOP00000013120 gi|25777635|ref|NP_733838.1| gi|7019439|ref|NP_037480.1| ENSP00000341479 ENSP00000375756 ENSGGOP00000013120 ENSP00000341479 ENSP00000375756 ENSP00000341479 9606.ENSP00000341479 NP_037480.1.87134 NP_037480.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]