SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013127 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013127
Domain Number 1 Region: 43-257
Classification Level Classification E-value
Superfamily Aquaporin-like 1.06e-32
Family Aquaporin-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013127   Gene: ENSGGOG00000013461   Transcript: ENSGGOT00000013505
Sequence length 295
Comment pep:novel chromosome:gorGor3.1:2b:130117879:130124256:-1 gene:ENSGGOG00000013461 transcript:ENSGGOT00000013505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLNVSLSFFFATFALCEAARRASKALLPVGAYEVFAREAMRTLVELGPWAGDFGPDLL
LTLLFLLFLAHGVTLDGASANPTVSLQEFLMAEESLPGTLLKLAAQGLGMQAACTLTRLC
WAWELSDLHLLQSLMAQSCSSALRTSVPHGALVEAACAFCFHLTLLYLRHSPPAYSVPAV
ALLVTVTAYTAGPFTSAFFNPALAASVTFACSGHTLLEYVQVYWLGPLTGMVLAVLLHQG
RLPRLFQRNLFYSQKNKYRAPRGKPAPASGDTQTPAKGSSGREPGCSGVEGPHSS
Download sequence
Identical sequences ENSGGOP00000013127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]