SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013142 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013142
Domain Number 1 Region: 52-124
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000248
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013142   Gene: ENSGGOG00000013476   Transcript: ENSGGOT00000013520
Sequence length 138
Comment pep:known_by_projection chromosome:gorGor3.1:3:46005300:46008565:1 gene:ENSGGOG00000013476 transcript:ENSGGOT00000013520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCVSMGLCVLGIIVMASTN
SLMWTFFSRGLSFSMSSAVASVTVTFSNILSSAFLGYVLYGECQEVLWWGGVFLILCGLT
LIHRKLPPTWKPLPHKQQ
Download sequence
Identical sequences G3RCB8
ENSGGOP00000013142 ENSGGOP00000013142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]