SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013152 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013152
Domain Number 1 Region: 145-452
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.5e-104
Family Transglutaminase core 0.000000107
Further Details:      
 
Domain Number 2 Region: 5-144
Classification Level Classification E-value
Superfamily E set domains 2.38e-40
Family Transglutaminase N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 581-679
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.22e-23
Family Transglutaminase, two C-terminal domains 0.0014
Further Details:      
 
Domain Number 4 Region: 469-575
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000139
Family Transglutaminase, two C-terminal domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013152   Gene: ENSGGOG00000013478   Transcript: ENSGGOT00000013531
Sequence length 680
Comment pep:known_by_projection chromosome:gorGor3.1:3:46025296:46067936:1 gene:ENSGGOG00000013478 transcript:ENSGGOT00000013531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMDASKELQVLHIDFLKQDNAVSHHTWEFQTSSPVFRRGQVFHLRLVLNQPLQSYHQLKL
EFSTGPNPSIAKHTLVVLDPRTPSDHYNWQATLQNESGKEVTVAVTSSPNAILGKYQLNV
KTGNHILKSEENILYLLFNPWCKEDMVFMPDEDERKEYILNDTGCHYVGAARSIKYKPWN
FGQFEKNVLDCCISLLTESSLKPTDRRDPVLVCRAMCAMMSFEKGQGMLIGNWTGDYEGG
TAPYKWTGCAPILQQYYNTKQAVCFGQCWILTTVLRALGIPARSVTAFDSTHDTERNLTV
DTYVNENGEKITNMTHDSVWNFHVWTDAWMKRPDLPKGYDGWQAVDATPQERSQGVFCCG
PSPLTAICKGDIFIVYDTRFVFSEVNGDRLIWLVKMVNGQEELHVISMETTSIWKNISTK
AVGQDRWRDITYEYEYPEGSSEERQVMDHAFLLLSSEREHRRPVKENFLHMSVQSDDVLL
GNPVNFTVILKRKTAALQNVNISGSFELQLYTGKKVAKLCDLNKTSQIQGQVSEVTLTLD
SKTYINSLAILDDEPVIRGFIIAEIVESEEIMASEVFTSFQYPEFSIELPNTGRIGQLLV
CNCIFKNTLAIPLTDVKFSLESLGISSLQTSDHETVQPGETIQSQIKCTPIKTGPKKFIV
KLSSKQVKEINAQKIVLITK
Download sequence
Identical sequences ENSGGOP00000013152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]