SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013236 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013236
Domain Number 1 Region: 33-464
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.44e-73
Family Integrin alpha N-terminal domain 0.00000512
Further Details:      
 
Domain Number 2 Region: 759-995
Classification Level Classification E-value
Superfamily Integrin domains 3.3e-43
Family Integrin domains 0.0025
Further Details:      
 
Domain Number 3 Region: 464-617
Classification Level Classification E-value
Superfamily Integrin domains 1.46e-25
Family Integrin domains 0.0022
Further Details:      
 
Domain Number 4 Region: 618-754
Classification Level Classification E-value
Superfamily Integrin domains 3.4e-22
Family Integrin domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013236   Gene: ENSGGOG00000013558   Transcript: ENSGGOT00000013617
Sequence length 1066
Comment pep:known_by_projection chromosome:gorGor3.1:5:33949824:33981450:-1 gene:ENSGGOG00000013558 transcript:ENSGGOT00000013617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGPSCAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPREVAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKSDPGHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYK
DPEDQGNLYIGYTMQVGSFILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEG
SQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVARPAVL
DPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFH
GFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQA
QALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNT
RTSEGSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAF
EVIGVTLHTRDLQVQLQLSTSSHQDNLWPMTLTLLVDYTLQTSLSMVNHRLQSFFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG
NGSWPCQPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
VLTCATGRAHCVWLECPIPDAPIVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRT
SIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCDFFK
RTRYYQIMPKYHAVRIREEERYPPPGSTLPTKKHWVTSWQTRDQYY
Download sequence
Identical sequences ENSGGOP00000013236 ENSGGOP00000013236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]