SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013261 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013261
Domain Number 1 Region: 1-385
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.92e-127
Family Family 1 of glycosyl hydrolase 0.0000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013261   Gene: ENSGGOG00000013597   Transcript: ENSGGOT00000013642
Sequence length 410
Comment pep:known_by_projection chromosome:gorGor3.1:4:22818075:22832371:1 gene:ENSGGOG00000013597 transcript:ENSGGOT00000013642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLS
WSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYHFDLPQALEDQGGWLSEAII
ESFDKYAQFCFSTFGDRVKQWITINEANVLSVMSYDLGMFPPGIPHFGTGGYQAAHNLIK
AHARSWHSYDSLFRKEQKGMVSLSLFAVWLEPADPNSVSDQEAAKRAITFHLDLFAKPIF
IDGDYPEVVKSQIASMSQKQGYPSSRLPEFTEEEKKMIKGTADFFAVQYYTTRLIKYQEN
KKGELGILQDAEVEFFPDPSWKNVDWIYVVPWGVRKLLKYIKDTYNNPVIYITENGFPQS
DPAPLDDTQRWEYFRQTFQELFKVLLLKKESCRSNKIQCKAWSLLAESNW
Download sequence
Identical sequences ENSGGOP00000013261 ENSGGOP00000013261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]