SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013332 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013332
Domain Number 1 Region: 287-544
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.29e-99
Family SMAD domain 0.0000000000946
Further Details:      
 
Domain Number 2 Region: 19-137
Classification Level Classification E-value
Superfamily SMAD MH1 domain 4.71e-41
Family SMAD MH1 domain 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013332   Gene: ENSGGOG00000013662   Transcript: ENSGGOT00000013714
Sequence length 552
Comment pep:known_by_projection chromosome:gorGor3.1:18:48789689:48843838:1 gene:ENSGGOG00000013662 transcript:ENSGGOT00000013714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
Download sequence
Identical sequences A0A024R274 A0A096N2U8 A0A1D5QTT6 A0A2K5JKB5 A0A2K5NH42 A0A2K5XWF3 A0A2K6BPF5 A0A2K6U3T9 F7GUQ9 G1RMF1 G3RCU6 G7PWS9 H2NWD4 H2QEJ6 Q13485
ENSPANP00000006643 9544.ENSMMUP00000024106 9598.ENSPTRP00000017047 9600.ENSPPYP00000010297 9606.ENSP00000341551 ENSPPYP00000010297 gi|4885457|ref|NP_005350.1| ENSMMUP00000024106 ENSP00000341551 ENSP00000381452 ENSCJAP00000003458 HR4503 ENSGGOP00000013332 ENSMMUP00000024106 ENSP00000341551 ENSGGOP00000013332 ENSPPYP00000010297 ENSPTRP00000017047 ENSNLEP00000014415 ENSCJAP00000003458 ENSNLEP00000014415 ENSP00000341551 ENSP00000381452 ENSPTRP00000017047 NP_001248019.1.72884 NP_005350.1.87134 NP_005350.1.92137 XP_001155601.1.37143 XP_002828272.1.23681 XP_004059477.1.27298 XP_005586732.1.63531 XP_008950853.1.60992 XP_008978080.1.60252 XP_009250661.1.23681 XP_009432308.1.37143 XP_010335105.1.74449 XP_011752539.1.29376 XP_011784152.1.43180 XP_011824440.1.47321 XP_011929907.1.92194 XP_011929908.1.92194 XP_012361829.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]