SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013354 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013354
Domain Number 1 Region: 446-675
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.63e-32
Family Voltage-gated potassium channels 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013354   Gene: ENSGGOG00000013686   Transcript: ENSGGOT00000013738
Sequence length 780
Comment pep:known_by_projection chromosome:gorGor3.1:11:62896960:62906457:-1 gene:ENSGGOG00000013686 transcript:ENSGGOT00000013738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNSVPEKAQNEADTNNADRFFHSHSSPPHHRPGHSRALHHYELHHHGVPHQRGESHHP
PEFQDFHDQALSSHVHQSHHHSEARNHGRAHGPTGFGLAPSQGTVPSHHSYSEDYHDELQ
RDGRRHHDGSQYSGFHQQSDSHYHRGSHHGRPQYLGENLSHYSSGVPHHSEASHHGGSYL
PHGPNPYSESFHHSEASHLSGLQHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQHGKS
PHHGETISPHSSVGSYQRGISDYHSEYHQGDHHPSEYHHGEHPHHTQHHYHRTHWHRDYH
QHRDHHGAYHSSYLHGDYVQNTSQLSIPHTSRSLIHDAPGPAASRTGVFPYHVAHPRGSA
HSMTRSSSTIRSRVTQMSKKVHTQDISTKDSEDWGKEEGQFQKRKTGRLQRTRKKGHSTN
LFQWLWEKLTFLIQGFREMIRNLTQSLAFETFIFFIVCLNTVMLVAQTFAEVEIRGEWYF
MALDSIFFCIYVVEALLKIIALGRSYFYDFWNNLDFFIMTMAVLDFLLMQTHSFAIYHQS
LFRILKVFKSLRALRAIRVLRRLSFLTSVQEVTGTLGQSLPSIAAILILMFTCLFLFSAV
LRALFRKSDPKRFQNIFTTIFTLFTLLTLDDWSLIYMDSRAQGAWYIIPILIIYIIIQYF
IFLNLVITVLVDSFQTALFKGLEKAKQERAARIQEKLLEDSLTELRAAEPKEVESEGTLL
KRLIEKKFGTMTEKQQELLFHYLQLVASVEQEQQKFRSQAAIIDEIVDTTFEAGEEDFRN
Download sequence
Identical sequences G3RCW5
ENSGGOP00000013354 ENSGGOP00000013354 XP_004051617.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]