SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013393 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013393
Domain Number 1 Region: 375-611
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.06e-37
Family Calponin-homology domain, CH-domain 0.0000884
Further Details:      
 
Domain Number 2 Region: 86-246,373-422
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.91e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 
Domain Number 3 Region: 734-767
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000632
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013393
Domain Number - Region: 768-796
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000232
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013393   Gene: ENSGGOG00000013726   Transcript: ENSGGOT00000013779
Sequence length 948
Comment pep:known_by_projection chromosome:gorGor3.1:22:1787253:1829643:-1 gene:ENSGGOG00000013726 transcript:ENSGGOT00000013779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKHETMNPAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLIQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGIGSVLLCLT
HSRGKADAILPLGFFFACFVFIPIKTAPGIDLENIVYYKDDTHYFVMTAKKQSLLDKGVI
LHDYADTELLLSRENVDQEALLSYAREAADFSTQQQLPSLDFAINHYGQPDVAMFDFTCM
YASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMDSAWMVRSWSLGTSP
LEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNINVNFLRPSQVRHLYDTGETK
DIHLEMESLVNSRTTPKLTRNESVARSSKLLGWCQRQTDGYAGVNVTDLTMSWKSGLALC
AIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKEMASVGEPDKLSMVM
YLTQFYEMFKDSLPSSDTLDLNAEEKAVLIASTRSPISFLSKLGQTISRKRSPKDKKEKD
LDGAGKRRKTSQSEEVFSYSSFMRISDRRMDVAVGNQNKVKYMATQLLAKFEENAPTQSI
GIRRQGSMKKEFPQNLGGSDTCYFCQKRVYVMERLSAEGKFFHRSCFKCEYCATTLRLSA
YAYDIEDGKFYCKPHYCYRLSGYAQRKRPAVAPLSGKRDWQEEEAKGPLQDGATTDANGR
ANAVASSTEGTPGSLTSLFGWVARHSLGLCDKAKGMSQHLQSNISSFGHQVAQNPLDSFF
MCQLLAFGVPFLYGLSEVLVQIRDSASCSLSLCVDELWLLSCLPCTVM
Download sequence
Identical sequences ENSGGOP00000013393 ENSGGOP00000013393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]