SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013400 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013400
Domain Number 1 Region: 51-79,113-310
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-56
Family Voltage-gated potassium channels 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013400   Gene: ENSGGOG00000013743   Transcript: ENSGGOT00000013786
Sequence length 368
Comment pep:known_by_projection chromosome:gorGor3.1:19:46399079:46401341:-1 gene:ENSGGOG00000013743 transcript:ENSGGOT00000013786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLEEVAFYGLGAAALARLREDEGCPVPPERPLPRRAFARQLWLLFEFPESSQAARVLAVV
SVLVILVSIVVFCLETLPDFRDDRDGTGLAAVAAAGPFPARLNGSSQMPGNPPRLPFNDP
FFVVETLCICWFSFELLVRLLVCPSKAIFFKNVMNLIDFVAILPYFVALGTELARQRGVG
QQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFSS
AVYFAEVDRVDSHFTSIPESFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTISL
PVPVIVSNFSYFYHRETEGEEAGMFSHVDTQPCGPLEGKANGGLVDGEVPELPPPLWAPP
GKHLVTEV
Download sequence
Identical sequences G3RD08
ENSGGOP00000013400 ENSGGOP00000013400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]