SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013404 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013404
Domain Number 1 Region: 8-180
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 9.81e-48
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013404   Gene: ENSGGOG00000013744   Transcript: ENSGGOT00000013790
Sequence length 191
Comment pep:known_by_projection chromosome:gorGor3.1:19:18721052:18746269:1 gene:ENSGGOG00000013744 transcript:ENSGGOT00000013790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPRKAVVVTELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGM
ATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSV
TISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQ
SEGKINYCHKH
Download sequence
Identical sequences ENSGGOP00000013404 ENSGGOP00000013404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]