SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013415 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013415
Domain Number 1 Region: 24-139
Classification Level Classification E-value
Superfamily PDZ domain-like 5.93e-18
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013415   Gene: ENSGGOG00000013751   Transcript: ENSGGOT00000013801
Sequence length 253
Comment pep:known_by_projection chromosome:gorGor3.1:19:3657683:3662409:1 gene:ENSGGOG00000013751 transcript:ENSGGOT00000013801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RELYAKIAEAFGIAPTEILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKT
EDALGLTITDNGAGYAFIKRIKEGSIINRIEAVCVGDSIEAINDHSIVGCRHYEVAKMLR
ELPKSQPFTLRLVQPKRAFDMIGQRSRSSKCPVEAKVTSGRETLRLRSGGAAMCPQPSEF
EEEASRKVDDLLESYMGIRDPELASTMVETSKKTASAQEFARCLDSVLGEFAFPDEFVVE
VWAAIGEAREACG
Download sequence
Identical sequences ENSGGOP00000013415 ENSGGOP00000013415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]