SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013477 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013477
Domain Number 1 Region: 50-324
Classification Level Classification E-value
Superfamily L domain-like 1.53e-43
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 578-664
Classification Level Classification E-value
Superfamily Fibronectin type III 5.13e-17
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013477   Gene: ENSGGOG00000013818   Transcript: ENSGGOT00000013865
Sequence length 740
Comment pep:known_by_projection chromosome:gorGor3.1:20:6180990:6195278:-1 gene:ENSGGOG00000013818 transcript:ENSGGOT00000013865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQTLLLLLLTVLRPSWADPPQEKVPLFRVTQQGPWGSSGSNATDSPCEGLPAADATALT
LANRNLERLPGCLPRTLRSLDASHNLLRALSTSELGHLEQLQVLTLRHNRIAALRWGPGG
PAGLHTLDLSYNQLASLPPCAGPVLSSLRALALAGNPLQALQPRAFACFPALQLLNLSCT
ALGRGAQGGIAEAAFAGEDGAPLVTLEVLDLSGTFLERVESGWIRDLPKLTSLYLRKMPQ
LTTLEGDIFKMTPNLQQLDCQDSPALASVATHIFQDTPHLQVLLFQNCNLSSFPPWTLDS
SQVLSINLFGNPLTCSCDLSWLLTDAKRTVLSRAADTMCAPAAGSSGRFSASLSLSQLPG
VCQSDKSTTLQASHPPCFNRSTYAQGPTVAPSAAPATRPAGDQQSVSKAPNVGSHTIAAW
PHSDAREGTAPSTTNSVAGHSNSSVFPRAASTTRTQHRGEHAPGLVLEPDISAASTPLAS
KLLGPFPTSWDRSISSPQPGQRTHATPQAPNPSPSEGEIPVLLLDDYSEEEEGRKEEVGT
PHQDVPCDYHPCKHLQTPCAELQRRWRCRCPGLSGEDTIPDPPRLQGVTETTDTSALVHW
CAPNSVVHGYQIRYSAEGWAGNQSVVGVIYATARQHPLYGLSPGTTYRVCVLAANRAGLS
QPRSSGWRSPCAAFTTKPSFALLLSGLCAASGLLLASTVVLSACLCRRGQTLRLQGCDTH
LVAYKNPAFDDYPLGLQTVS
Download sequence
Identical sequences G3RD80
ENSGGOP00000013477 XP_004061836.1.27298 XP_018872873.1.27298 ENSGGOP00000013477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]