SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013478 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013478
Domain Number 1 Region: 59-119
Classification Level Classification E-value
Superfamily R3H domain 0.00000000104
Family R3H domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013478
Domain Number - Region: 343-407
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0269
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013478   Gene: ENSGGOG00000013817   Transcript: ENSGGOT00000013866
Sequence length 476
Comment pep:known_by_projection chromosome:gorGor3.1:8:23160494:23168670:1 gene:ENSGGOG00000013817 transcript:ENSGGOT00000013866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMKASRVTLGEAGARACWPLGTPRVAATRREAAALPPVTLALLCLDGVFLSSAENDFVH
RIQEELDRFLLQKQLSKVLLFPPLSSRLRYLIHRTAENFDLLSSFSVGEGWKRRTVICHQ
DIRAPSSDGLSGPCRAPASCPSKYHGPRPISNQGAAAVPRGARAGRWYRGRKPDQPLYVP
RVLRRQEEWGLTSTLVLKREAPAGRDPEEPGDVGAGDPTSDQGLPVLMTQGTEDLKGPGQ
RCENEPLLDPVGPEPPGPESQSGKGDVVEMATRFGSTLQLDLEEGKESLLEKRLVAEEEE
DEEDGPSSCSEDDYSELLQEITDNLTKKEIQIEKIHLDTSSFVEELPGEKDLAHVVEIYD
FEPALKTEDLLATFSEFQEKGFRIQWVDDTHALGIFPCLASAAEALTREFSVLKIRPLTQ
GTKQSKLKALQRPKLLRLVKERPQTNVTVARRLVARALGLQHKKKERPAVRGPLPP
Download sequence
Identical sequences ENSGGOP00000013478 ENSGGOP00000013478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]