SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013493 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013493
Domain Number 1 Region: 566-654
Classification Level Classification E-value
Superfamily PH domain-like 3.81e-18
Family Third domain of FERM 0.0045
Further Details:      
 
Domain Number 2 Region: 380-473
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 285-331,503-565
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000977
Family Second domain of FERM 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013493
Domain Number - Region: 25-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00114
Family Ubiquitin-related 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013493   Gene: ENSGGOG00000013823   Transcript: ENSGGOT00000013881
Sequence length 677
Comment pep:known_by_projection chromosome:gorGor3.1:20:6216265:6265687:-1 gene:ENSGGOG00000013823 transcript:ENSGGOT00000013881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFA
LWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKA
VSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKNNKEPIIEDILNLESSPTASGSSVSP
GLYSKTMTPIYDPINGTPASSTMTWFSDSPLTEQNCSILAFSQPPQSPEALADMYQPRSL
VDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAI
LLEEIDCTEEEMLIFAALQYHISKLSLSAETQDFTSESEVDEIEAALSNLEVTLEGGKAD
SLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNL
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADS
SYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKKHKSKQLAARILEAH
QNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIP
VTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQ
NETLDEDLFHKLTGGQD
Download sequence
Identical sequences G3RD95
ENSGGOP00000013493 XP_004061839.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]