SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013501 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013501
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.68e-30
Family G proteins 0.00089
Further Details:      
 
Domain Number 2 Region: 415-582
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.69e-20
Family G proteins 0.023
Further Details:      
 
Domain Number 3 Region: 168-269,311-366
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000023
Family Calmodulin-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013501   Gene: ENSGGOG00000013831   Transcript: ENSGGOT00000013889
Sequence length 620
Comment pep:known_by_projection chromosome:gorGor3.1:16:720367:726336:1 gene:ENSGGOG00000013831 transcript:ENSGGOT00000013889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPPRAEEITIPADVTPEKVPTHIVDYSE
AEQTDEELREEIHKANVVCVVYDVSEEATIEKIRTKWIPLVNGGTTRGPRVPIILVGNKS
DLRSGSSMEAVLPIMSQFPEIETCVECSAKNLRNISELFYYAQKAVLHPTAPLYDPEAKQ
LRPACAQALTRIFRLSDQDLDQALSDEELNAFQQKSCFGHPLAPQALEDVKTVVCRNVAG
GVWEDRLTLDGFLFLNTLFIQRGRHETTWTILRRFGYSDALELTADYLSPPIHVPPGCST
ELNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLH
GYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDSQAHAITVTREKRLDQEKGQTQRSVLL
CKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLL
ATSLDAACDVACLMFDGSDPKSFAHCASVYKCHYMDGQTPCLFVSSKADLPQGVAVSGPS
PAEFCHKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVV
GAAVAAVLSFSLYRVLVKSQ
Download sequence
Identical sequences ENSGGOP00000013501 ENSGGOP00000013501 XP_018867325.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]