SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013506 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013506
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-16
Family THAP domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013506
Domain Number - Region: 99-240
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.00126
Family Outer membrane efflux proteins (OEP) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013506   Gene: ENSGGOG00000013846   Transcript: ENSGGOT00000013894
Sequence length 304
Comment pep:known_by_projection chromosome:gorGor3.1:16:58087997:58088911:1 gene:ENSGGOG00000013846 transcript:ENSGGOT00000013894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRL
CSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQ
QQSSPSASTAQTAQLQPNLVSASAAVLLTLQAAVDSSQAPGSVPPAPITPTGEDVKPIDL
TVQVEFAAAEGAAAAAAASELQAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHSYSLSS
GTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMAVIRK
KHGM
Download sequence
Identical sequences G3RDA8
XP_004057889.1.27298 ENSGGOP00000013506 ENSGGOP00000013506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]