SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013510 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013510
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily NTF2-like 2.34e-20
Family NTF2-like 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013510   Gene: ENSGGOG00000013851   Transcript: ENSGGOT00000013898
Sequence length 121
Comment pep:novel chromosome:gorGor3.1:10:14272631:14273015:1 gene:ENSGGOG00000013851 transcript:ENSGGOT00000013898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGGKPMWEMTGPIFIQRSVIEFYNNRTQLSTIYIDISRLRREGEQLEGKAAIVKKSSSLL
FHKIQHSIIVQDRQPTPANCILSMVVGQPNANEDPIMGLHQMFLWFALMTDMFRPALHDF
T
Download sequence
Identical sequences ENSGGOP00000013510 ENSGGOP00000013510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]