SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013531 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013531
Domain Number 1 Region: 158-437
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.79e-18
Family WD40-repeat 0.007
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013531
Domain Number - Region: 1063-1191
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.068
Family Apolipoprotein A-I 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013531   Gene: ENSGGOG00000013857   Transcript: ENSGGOT00000013920
Sequence length 1409
Comment pep:known_by_projection chromosome:gorGor3.1:16:58118648:58130058:1 gene:ENSGGOG00000013857 transcript:ENSGGOT00000013920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCASIDIEDATQHLRDILKLDRPAGGPSAESPRPSSAYNGDLNGLLVPDPLCSGDGTS
ANKTGLRTMPPINLQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKI
QPVAKYDWEQKYYYGNLIAVSNSFLAYAIRAANNGSAMVRVISVSTSERTLLKGFTGSVA
DLAFAHLNSPQLACLDEAGNLFVWRLALVNGKIQEEILVHIRQPEGTPLNHFRRIIWCPF
IPEESEDCCEESSPTVALLHEDRAEVWDLDMLRSRHSTWPVDVSQIKQGFIVVKGHSTCL
SEGALSPDGTVLATASHDGYVKFWQIYIEGQDEPRCLHEWKPHDGRPLSCLLFCDNHKKQ
DPDVPFWRFLITGADQNRELKMWCTVSWTCLQTIRFSPDIFSSVSVPPSLKVCLDLSAEY
LILSDVQRKVLYVMELLQNQEEGHACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPA
EEENDSLGADGTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAPLPTHTA
HEDFTFGESRPELGSEGLVSAAHGSQPDLRRIVELPAPADFLSLSSETKPKLMTPDAFMT
PSASLQQVLSQDRGTWECLSHRPQVLFPASPQITASSLTAVSAMSSTSAVDPSLTRPPEE
LTLSPKLQLDGSLTMSSSGSLQASPRGLLPGLLPAPADKLTPKGPGQVPTAASALSLELQ
EVEPLGLPQASPSRTRSPDVISSASTALSQDIPEIASEALSRGFGSSAPEGLEPDSMASA
ASALHLLSPRPRPGPELGPQLGLDGGPGDGDRHNTPSLLEAALTQEASTPDSQVWPTAPD
ITRETCSTLAESPRNGLQEKHKSLAFHRPPYHLLQQRDSQDASAEQSDHDDEVASLASAS
GGFGTKVPAPRLPAKDWKTKGSPRTSPKLKRKSKKDDGDAAMGSRLTEHQVAEPPEDWPA
LIWQQQRELAELRHSQEELLQRLCTQLEGLQSTVTGHVERALETRHEQEQRRLERALAEG
QQRGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVAT
KLTAVEGSMKENISKLLKSKNLTDAIARAAADTLQGPMQAAYREAFQSVVLPAFEKSCQA
MFQQINDSFRLGTQEYLQQLESHMKSRKAREQEAREPVLAQLRGLVSTLQSATEQMAATV
AGSVRAEVQHQLHVAVGSLQESILAQVQRIVKGEVSVALKEQQAAVTSSIMQAMRSAAGT
PVPSAHLDCQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLYVCETVDPAQVFGQPPCP
LSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQF
LQAEPHNSLGKAARRLSLMLHGLVTPSLP
Download sequence
Identical sequences ENSGGOP00000013531 ENSGGOP00000013531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]