SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013566 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013566
Domain Number 1 Region: 27-156
Classification Level Classification E-value
Superfamily Cupredoxins 3.47e-43
Family Ephrin ectodomain 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013566   Gene: ENSGGOG00000013918   Transcript: ENSGGOT00000013957
Sequence length 207
Comment pep:novel chromosome:gorGor3.1:1:134062176:134067603:1 gene:ENSGGOG00000013918 transcript:ENSGGOT00000013957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPH
YEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSL
GFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERRARVLPRSPGGGGIPAACTGGTNS
DRQDGALMGEIRGSEVTLAGACPLITG
Download sequence
Identical sequences A0A2J8Q307 A0A2J8VG70
ENSGGOP00000013566 XP_003817144.1.60992 XP_524893.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]