SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013570 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013570
Domain Number 1 Region: 162-297
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000161
Family WD40-repeat 0.01
Further Details:      
 
Domain Number 2 Region: 166-271,305-536
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000118
Family YVTN repeat 0.056
Further Details:      
 
Domain Number 3 Region: 1252-1293
Classification Level Classification E-value
Superfamily RING/U-box 0.00000848
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013570   Gene: ENSGGOG00000013880   Transcript: ENSGGOT00000013961
Sequence length 1428
Comment pep:known_by_projection chromosome:gorGor3.1:3:186185114:186438439:1 gene:ENSGGOG00000013880 transcript:ENSGGOT00000013961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENEPDHENVEQSLCAKTSEEELNKSFNLEASLSKFSYIDLDKELEFKNDLIDDKEFDIP
QVDTPPTLESILNETDDEDESFVLEDPTLLNIDTIDSHSYDTSSVASSDSGDRTNLKRKK
KLPDSFSLHGSVMRHSLLKGISAQIVSAADKVDAGLPTAIAVSSLIAVGTSHGLALIFGK
FQNQALRLCLGSTSVGGQYGAISALSINNDCSRLLCGFAKGQITMWDLASGKLLRSITDA
HPPGTAILHIKFTDDPTLAICNDSGGSVFELTFKRVMGVRTCESRCLFSGSKGEVCCIEP
LHSKPELKDHPITQFSLLAMASLTKILVIGLKPSLKVWMTFPYGRMDPSSVPLLAWHFVA
VQNYVNPMLAFCRGDVVHFLLVKRDESGAIHVTKQKHLHLYYDLINFTWINSRTVVLLDS
VEKLHVIDRQTQEELETVEISEVQLVYNSSHFKSLATGGNVSQALALVGEKACYQSISSY
GGQIFYLGTKSVYVMMLRSWRERVDHLLKQDCLTEALALAWSFHEGKAKAVVGLSGDASK
RKAIVADRMVEILFHYADRALKKCPDQGKIQVMEQHFQDTVPVIVDYCLLLQRKDLLFSQ
MYDKLSENSVAKGVFLECLEPYILSDKLVGITPQVMKDLIVHFQDKKLMENVEALIVHMD
ITSLDIQQVVLMCWENRLYDAMIYVYNRGMNEFISPMEKLFRVIAPPLNAGKTLTDEQVV
MGNKLLVYISCCLAGRAYPLGDIPEDLVPLVKNQVFEFLIRLHSAEASPEEEVYPYIRTL
LHFDTREFLNVLALTFEDFKNDKQAVEYQQRIVDILLKVMVENSDFTPSQVGCLFTFLAR
QLAKPDNTLFVNRTLFDQVLEFLCSPDDDSRHSERQQVLLELLQAGGIVQFEESRLIRMA
EKAEFYQICEFMYEREHQYDKIIDCYLRDPLREEEVFNYIHNILSIPGHSAEEKQSVWQK
AMDHIEELVSLKPCKAAELVATHFSGHIETVIKKLQNQVLLFKFLRSLLDPREGIHINQE
LLQISPCITEQFIELLCQFNPTQVIETLQVLECYRLEETIQITQKYQLHEVTAYLLEKKG
DIHGAFLIMLERLQSKLQEVTHQGENTREDPSLKDVEDTMVETIALCQRNSHNLNQQQRE
ALWFPLLEAMMAPQKLSSSAIPHLHSEALKSLTMQVLNSMAAFIALPSILQRILQDPVYG
KGKLGEIQGLILGMLDTFNYEQTLLETTTSLLNQDLHWSLCNLRASVTRGLNPKQDYCSI
CLQQYKRRQEMADEIIVFSCGHLYHSFCLQNKECTVEFEGRTRWTCYKCSSSNKVGKLSE
NSSEIKKGRITPSQVKMSPSYHQSKGDPTAKKGTSEPVLDPQQIQAFDQLCRLYRGSSRL
ALLTELSQNRSSESYRPFSGSQSAPAFNSIFQNENFQLQLIPPPVTED
Download sequence
Identical sequences ENSGGOP00000013570 ENSGGOP00000013570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]