SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013598 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013598
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000741
Family THAP domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013598   Gene: ENSGGOG00000013943   Transcript: ENSGGOT00000013990
Sequence length 257
Comment pep:known_by_projection chromosome:gorGor3.1:15:50341748:50352929:-1 gene:ENSGGOG00000013943 transcript:ENSGGOT00000013990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAP
ACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPAPKGGEEGDQAGRLDTRGELQAARH
SEAAPGPVSCTRPRAGKQAAASQITCENELVQTQPHADNPSNTVTSVPTHCEEGPVHKST
QISLRRPRHRSVGIQAKVKAFGKRLCNATTQTEELWSRTSSLFDIYSSDSETDTDWDIKS
EQSDLSYIAVQVKEETC
Download sequence
Identical sequences G3RDJ2
ENSGGOP00000013598 XP_004056471.1.27298 ENSGGOP00000013598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]