SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013621 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013621
Domain Number 1 Region: 43-127
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000663
Family FHA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013621   Gene: ENSGGOG00000013968   Transcript: ENSGGOT00000014013
Sequence length 184
Comment pep:known_by_projection chromosome:gorGor3.1:4:121707271:121717567:-1 gene:ENSGGOG00000013968 transcript:ENSGGOT00000014013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSFEDADTEETVTCLQMTVYHPGHLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTF
QDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFG
EYQFLMEKEDGESLEFFETQFILSPRSLLQENNWPPHRPIPEYGTYSLCSFQSSSPTEMD
ENES
Download sequence
Identical sequences A0A2I2YGY6
XP_004040340.1.27298 XP_018881200.1.27298 ENSGGOP00000013621 ENSGGOP00000013621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]