SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013630 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000013630
Domain Number - Region: 64-134
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0443
Family C-type lectin domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013630   Gene: ENSGGOG00000013969   Transcript: ENSGGOT00000014022
Sequence length 413
Comment pep:known_by_projection chromosome:gorGor3.1:7:1492838:1502524:-1 gene:ENSGGOG00000013969 transcript:ENSGGOT00000014022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNVSGILETASLPLVSATWPQPSPPPAVPAGPQMDHMGNSSQGAPWLFLTSALARGVSG
IFVWTALVLTCHQIYLHLRSYTVPQEQRYIIRLLLIVPIYAFDSWLSLLLLGDHQYYVYF
DSVRDCYEAFVIYSFLSLCFQYLGGEGAIMAEIRGKPIKSSCFYGTCCLRGMTYSIGFLR
FCKQATLQFCLVKPVMAVTTIILQAFGKYHDGDFNVRSGYLYVTLIYNASVSLALYALFL
FYFTTRELLRPFQPVLKFLTIKAVIFLSFWQGLLLAVLERCGVIPEVETSGGNKLGAGTL
AAGYQNFIICVEMLFASVALRYAFPCQVYSEKKENSPAPPAPMQSISSGIRETVSPQDIV
QDAIHNFSPAYQHYTQQATHEAPRPGTHPGGGSGGSRKSRSLEKRMLIPSEDL
Download sequence
Identical sequences XP_004045064.1.27298 ENSGGOP00000013630 ENSGGOP00000013630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]