SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013652 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013652
Domain Number 1 Region: 33-382
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.81e-140
Family Calpain large subunit, catalytic domain (domain II) 0.00000000000226
Further Details:      
 
Domain Number 2 Region: 385-530
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.66e-52
Family Calpain large subunit, middle domain (domain III) 0.0000000489
Further Details:      
 
Domain Number 3 Region: 537-716
Classification Level Classification E-value
Superfamily EF-hand 4.7e-38
Family Penta-EF-hand proteins 0.0000000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013652   Gene: ENSGGOG00000008027   Transcript: ENSGGOT00000014046
Sequence length 720
Comment pep:known_by_projection chromosome:gorGor3.1:1:204146667:204208799:1 gene:ENSGGOG00000008027 transcript:ENSGGOT00000014046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGPGRAPAERSAESPRPFSAQYGRRDRSMAGIAAKLAKDREAAEGLGSHERAIKYLNQD
YEALRNECLEAGTLFQDPSFPAIPSALGFKELGPYSSKTRGIEWKRPTEICADPQFIIGG
ATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYAGIFHFQFWQYGEWVE
VVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTGGI
AEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKLVKGHAYSVTGAEE
VESNGSLQKLIRIRNPWGEVEWTGRWNDNCPSWNTIDPEERERLTRRHEDGEFWMSFSDF
LRHYSRLEICNLTPDTLTSDTYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKR
GCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSD
TFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEF
DISEDDIDDGFRRLFAQLAGEFGEVEGFQVSRMQATCNRVFEKCQDIKSDGFSIETCKIM
VDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDIDRSGTMNSYEMRKALEEAGFKMPC
QLHQVIVARFADDQLIINFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
Download sequence
Identical sequences ENSGGOP00000013652 ENSGGOP00000007856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]