SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013665 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013665
Domain Number 1 Region: 34-182
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-41
Family C-type lectin domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013665   Gene: ENSGGOG00000014011   Transcript: ENSGGOT00000014059
Sequence length 186
Comment pep:known_by_projection chromosome:gorGor3.1:16:19850184:19874048:1 gene:ENSGGOG00000014011 transcript:ENSGGOT00000014059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRWTLWAAAFLTLHSAQAFPQTDINISPALPELPLPSLCPLFWMEFKGHCYRFFPLNKT
WAEADLYCSEFSVGRKSAKLASIHSWEENVFVYDLVNSCVPGIPADVWTGLHDHRQEGQF
EWTDGSSYDYSYWDGSQPDDGVHTDPEEEDCVQIWYRPTSALRSWNDNTCSRKFPFVCKI
PSLTIH
Download sequence
Identical sequences G3RDQ5
ENSGGOP00000013665 ENSGGOP00000013665 XP_004057330.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]