SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013668 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013668
Domain Number 1 Region: 57-96,155-359,386-503
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.41e-112
Family TRM1-like 0.0000652
Further Details:      
 
Domain Number 2 Region: 601-629
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000196
Family CCCH zinc finger 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013668   Gene: ENSGGOG00000014007   Transcript: ENSGGOT00000014062
Sequence length 661
Comment pep:known_by_projection chromosome:gorGor3.1:19:13355437:13366967:-1 gene:ENSGGOG00000014007 transcript:ENSGGOT00000014062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLMQGSSLWLSFTFRSARVLSRARFFEWQSPGLPNPAAMENGTGPYGEERPREVQETTVT
EGAAKIAFPSANEVFYNPVQEFNRDLTCAVITEFARIQLGAKGIQIKVPGEKDTQKVVVD
LSEQEEEKVELKESENLASGDQPRTAAVGEICEEGLHVLEGLAASGLRSIRFALEVPGLR
SVVANDASTRAVDLIRRNVQLNDVAHLVQPSQADARMLMYQHQRVSERFDVIDLDPYGSP
ATFLDAAVQAVSEGGLLCVTCTDMAVLAGNSGETCYSKYGAMALKSRACHEMALRIVLHS
LDLRANCYQRFVVPLLSISADFYVRVFVRVFTGQAKVKASASKQALVFQCVGCGAFHLQR
LGKASGVPSGRVKFSAACGPPVTPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSAN
PGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTPSLLQLRSALLHADFRVSL
SHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIRED
ANPSSRQRGLKRFQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRA
ARLKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQSPPGPGAAAGPGI
D
Download sequence
Identical sequences ENSGGOP00000013668 ENSGGOP00000013668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]