SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013669 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013669
Domain Number 1 Region: 38-193
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 6.47e-85
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000446
Further Details:      
 
Domain Number 2 Region: 198-365
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.87e-35
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013669   Gene: ENSGGOG00000014018   Transcript: ENSGGOT00000014063
Sequence length 462
Comment pep:known_by_projection chromosome:gorGor3.1:7:154457899:154467339:-1 gene:ENSGGOG00000014018 transcript:ENSGGOT00000014063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLPAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
PRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVL
ASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALPAPGA
ADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
Download sequence
Identical sequences G3RDQ9
ENSGGOP00000013669 ENSGGOP00000013669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]