SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013695 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000013695
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.0209
Family Molybdopterin synthase subunit MoaE 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013695   Gene: ENSGGOG00000014042   Transcript: ENSGGOT00000014089
Sequence length 184
Comment pep:known_by_projection chromosome:gorGor3.1:1:130059275:130062396:1 gene:ENSGGOG00000014042 transcript:ENSGGOT00000014089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI
KDLIKVAVKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLL
IECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLD
EGKL
Download sequence
Identical sequences G3RDT4
XP_004026668.1.27298 ENSGGOP00000013695 ENSGGOP00000013695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]