SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013700 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013700
Domain Number 1 Region: 376-616,649-716
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.96e-53
Family Diacylglycerol kinase-like 0.024
Further Details:      
 
Domain Number 2 Region: 1-118
Classification Level Classification E-value
Superfamily EF-hand 4.71e-48
Family EF-hand modules in multidomain proteins 0.000002
Further Details:      
 
Domain Number 3 Region: 186-252
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Domain Number 4 Region: 45-58,105-183
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000962
Family Calmodulin-like 0.028
Further Details:      
 
Domain Number 5 Region: 256-324
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000882
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013700   Gene: ENSGGOG00000014039   Transcript: ENSGGOT00000014094
Sequence length 737
Comment pep:known_by_projection chromosome:gorGor3.1:12:53994645:54017923:1 gene:ENSGGOG00000014039 transcript:ENSGGOT00000014094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIY
LEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFK
LYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEW
VRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKY
TVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC
VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNL
STSEALRIDPVPNTHPLLVFVNPKSGGKQGQRHRVLWKFQYILNPRQVFNLLKDGPEIGL
RLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYE
GQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFH
IMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIA
VLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVG
LEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMP
MLMGPPPRSTNFFGFLS
Download sequence
Identical sequences ENSGGOP00000013700 ENSGGOP00000013700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]