SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013747 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013747
Domain Number 1 Region: 157-186,239-479
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.98e-81
Family Eukaryotic proteases 0.00000000648
Further Details:      
 
Domain Number 2 Region: 52-115
Classification Level Classification E-value
Superfamily GLA-domain 4.54e-26
Family GLA-domain 0.0000618
Further Details:      
 
Domain Number 3 Region: 105-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000218
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013747   Gene: ENSGGOG00000014085   Transcript: ENSGGOT00000014141
Sequence length 500
Comment pep:known_by_projection chromosome:gorGor3.1:13:96346752:96374567:1 gene:ENSGGOG00000014085 transcript:ENSGGOT00000014141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSEDRDTVLGHTMGRPLHLVLLSASLAGLLLLGESLFIRREQANNILARVTRANSFLEEM
KKGHLERECMEETCSYEEAREVFEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGLGEY
TCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTG
PYPCGKQTLERRKRSVAQATSSSGEAPDSITWKPYDATDLDPTENPFDLLDLNQTQPERG
DNNLTRIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRV
GDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDW
AESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYN
TKQEDACQGDSGGPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMRT
RGLPKANSHAPEVVTSSPLK
Download sequence
Identical sequences ENSGGOP00000013747 ENSGGOP00000013747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]