SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013753 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000013753
Domain Number - Region: 34-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000582
Family I set domains 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013753   Gene: ENSGGOG00000014097   Transcript: ENSGGOT00000014147
Sequence length 199
Comment pep:known_by_projection chromosome:gorGor3.1:2b:92467970:92491648:1 gene:ENSGGOG00000014097 transcript:ENSGGOT00000014147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQ
ILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDRSHANYYFCNLSIFDPPPFK
VTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEY
MFMRAVNTAKKSRLTDVTL
Download sequence
Identical sequences G3RDY9 H2QJA1
ENSGGOP00000013753 XP_001173460.1.37143 XP_003820828.1.60992 XP_004033135.1.27298 ENSGGOP00000013753 ENSPTRP00000021947 ENSPTRP00000021947 9598.ENSPTRP00000021947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]