SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013758 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013758
Domain Number 1 Region: 62-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000285
Family LIM domain 0.012
Further Details:      
 
Domain Number 2 Region: 31-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000138
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013758   Gene: ENSGGOG00000014099   Transcript: ENSGGOT00000014152
Sequence length 304
Comment pep:known_by_projection chromosome:gorGor3.1:9:119876119:119883371:-1 gene:ENSGGOG00000014099 transcript:ENSGGOT00000014152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARGELGPARESAGGDLLLALLARRADLRREIPLCAGCDQHILDRFILKALDRHWHSKC
LKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHC
FACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPREPSLAEMGPANGLY
RSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYQELRPGSPYGVPPSPAAPQSLPGPQPL
LSSLVYPDTSLGLVPSGVPGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVD
HAQF
Download sequence
Identical sequences ENSGGOP00000013758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]