SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013763 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013763
Domain Number 1 Region: 17-364
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.04e-62
Family beta-Lactamase/D-ala carboxypeptidase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013763   Gene: ENSGGOG00000014102   Transcript: ENSGGOT00000014157
Sequence length 500
Comment pep:known_by_projection chromosome:gorGor3.1:1:23723606:23733762:-1 gene:ENSGGOG00000014102 transcript:ENSGGOT00000014157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPRHPEPVPLAHPLPVLKEALEKVDQILRQAMSAPGVAAMSAVVIHNDTVLWTGNFGKK
NGSDPASGAPNEYTMYRISSISKIFPVLMLYRLWEEGIVASLDDPLERYASTFTINNPLG
LASAEQQGLILRRMASQLSGLPRRLRSTSLLWKGSTQEALNLLKDDVLVVDPGTRCHYST
LAFSLLAHVLAAHTAQGDYQRWVSENVLEPLGMADTGFDLTPDVRARLAAGFYGSGRPAP
LYDLGWYRPSGQMYSTAADLAKLAVALLGGGPRRLLRPDAAKTLLAPLLACPGAYFANET
GTPWEFHAQRGYRVVRKDGDLDGYAATFSLVPPLRLGLVLLLAGPRPPGPDLVARAYDEL
LPALERALREAEPGPAPPPSARPFAGYFTFANLTFYEVRAGPAGELRLRQFGPRVEALVP
PAFRTLALRHLHGRVFQLHVAREFPCALPLGDAWLSLEAQHGQLVNFYPLDYHGLSPGFD
VPGLNTYRVLRLQGKPVFKT
Download sequence
Identical sequences ENSGGOP00000013763 ENSGGOP00000013763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]