SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013803 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013803
Domain Number 1 Region: 36-153
Classification Level Classification E-value
Superfamily TPR-like 1.12e-19
Family Tetratricopeptide repeat (TPR) 0.0081
Further Details:      
 
Domain Number 2 Region: 848-886
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000162
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Domain Number 3 Region: 900-934
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000275
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 4 Region: 498-527
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000824
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013803
Domain Number - Region: 771-803
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000159
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 627-658
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00255
Family CCCH zinc finger 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013803   Gene: ENSGGOG00000014138   Transcript: ENSGGOT00000014197
Sequence length 993
Comment pep:known_by_projection chromosome:gorGor3.1:22:25670693:25710385:1 gene:ENSGGOG00000014138 transcript:ENSGGOT00000014197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQKRKADIEKGLQFIQSTLPLKQEEYEAFLLKLVQNLFAEGNDLFREKDYKQALVQYM
EGLNVADYAASDQVALPRELLCKLHVNRAACYFTMGLYEKALEDSEKALGLDSESIRALF
RKARALNELGRHKEAYECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETF
SLLSNGTAAGVADQGTSNGLGSIDDIETGNVPDTREQVENGAPRDCYVDPRGSPALLPST
PTMPLFPHVLDLLAPLDSSRTLPSTESLDDFSDGDVFGPELDTLLDSLSLVQGGLSGSGV
PSELPQLIPVFPGGTPLLPPVVGGSIPVSSPLPPASFGLVMDPSKKLAASVLDALDPPGP
TLDPLDLLPYSETRLDALDSFGSTRGSLDKPDSFMEETNSQDHRPPSGAQKPTPSPEPCM
PNTALLIKNPLAATHEFKQACQLCYPKTGPRAGDYTYREGLEHKCKRDILLGRLRSSEDQ
TWKRIRPRPTKTSFVGSYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDL
LFDPLGGVKRGSLTIAKLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHS
FYNNKCLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWL
LQQYSGMTHEDIVQESKKYWQQMEAHAGKASSSMGAPRTHGPSTFDLQMKFVCGQCWRNG
QVVEPDKDLKYCSAKARHCWTKERRVLLVMSKAKRKWVSVRPLPSIRNFPQQYDLCIHAQ
NGRKCQYVGNCSFAHSPEERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTPISSRE
GEKQIQMPTDYADIMMGYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAFRF
PMGEFRLCDRLQKGKACPDGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCPRDD
DFGKYNFLLQEDGDLAGATPEAPAAAATATTGE
Download sequence
Identical sequences ENSGGOP00000013803 ENSGGOP00000013803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]