SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013814 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013814
Domain Number 1 Region: 177-376
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.37e-60
Family Reprolysin-like 0.00000188
Further Details:      
 
Domain Number 2 Region: 395-470
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 7.07e-21
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013814   Gene: ENSGGOG00000014156   Transcript: ENSGGOT00000014209
Sequence length 925
Comment pep:known_by_projection chromosome:gorGor3.1:5:141540860:141635476:-1 gene:ENSGGOG00000014156 transcript:ENSGGOT00000014209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRGSEEGNPKLQHELIIPQWKTSESPMREKHPLKAELRVTAEGRELILDLEKNEQLFAPS
YTETHYTSSGNPQTTTRKSEDHCFYHGTVRETELSSVTLSTCRGIRGLITVSSNLSYVIE
PLPDSKGQHLIYRSEHLKPPPGNCGFEHSKPTTRDWALQFTQQTKKRPRRMKREDLNSMK
YVELYLVADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHGNMCE
VSENPYSTLWSFLSWRRKLLAQKYHDNAQLITGMSFHGTTIGLAPLMAMCSVYQSGGVNM
DHSENAIGVAATMAHEMGHNFGMTHDSADCCSASAADGGCIMAAATGHPFPKVFNGCNRR
ELDRYLQSGGGMCLSNMPDTRMLYGGRRCGNGYLEDGEECDCGEEEECNNPCCNASNCTL
RPGAECAHGSCCHQCKLLAPGTLCREQARQCDLPEFCTGKSPHCPTNFYQMDGTPCEGGQ
AYCYNGMCLTYQEQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDMNGEHRKCNMRDA
KCGKIQCQSSEARPLESNAVPIDTTIIMNGRQIQCRGTHVYRGPEEEGDMLDPGLVMTGT
KCGYNHICFEGQCRNTSFFETEGCGKKCNGHGVCNNNQNCHCLPGWAPPFCNTPGHGGSI
DSGPMPPESVGPVVAGVLVAILVLAVLMLMYYCCRQNNKLGQLKPSALPSKLRQQFSCPF
RVSQNSGTGHANPTFKLQTPQGKRKVISTPEIPRKPSQPPPRPPPDYLRGGSPPAPLPAH
LSRAARNSPGPGSQIERTESSRRPPPSRPIPPAPNCIVSQDFSRPRPPQKALPANPVPGR
RSLPRPGGASPLRPPGAGPQQSRPLAAPAPKVSPREALKVKAGTRGLQGGRCRVEKTKQF
MLLVVWTELPEQKPRAKHSCFLVPA
Download sequence
Identical sequences ENSGGOP00000013814 ENSGGOP00000013814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]