SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013820 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013820
Domain Number 1 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 8.13e-24
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 478-583
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000166
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013820   Gene: ENSGGOG00000014162   Transcript: ENSGGOT00000014216
Sequence length 589
Comment pep:known_by_projection chromosome:gorGor3.1:4:2829641:2851982:1 gene:ENSGGOG00000014162 transcript:ENSGGOT00000014216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVGPRTPALSRSRGRRAMCWVSTISFMAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGY
LHKKGGTQLQLLKWPLRFVIIHKRCVYYFKSSTSASPQGAFSLSGYNRVMRAAEETTSNN
VFPFKIIHVSKKHRTWFFSASSEDERKSWMALLRREIGHFHEKKDLPLDTSDSSSDTDSF
YGAVERPVDISLSPCPTDNEDYEHDDEDDSYLEPDSPEPGRLEDALMHPPAYPPPPVPTP
RKPAFSDMPRAHSFTSKGPGPLLPPPPPKHGLPDVGLAAEDSKRDPLCPRRAEPCPRVPA
TPRRMSDPPLSTMPTAPGLRKPPCFRESASPSPEPWTPGHGACSTSSAAIMATATSRNCD
KLKSFHLSPRGPPTSEPPPVPANKPKFLKTAEEDPPREAAMPGLFVPPVAPRPPALKLPV
PEAMARPAVLPRPEKPQLPHLQRSPPDGQSFRSFSFEKPRQPSQADTGGDDSDEDYEKVP
LPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYR
IFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR
Download sequence
Identical sequences G3S427
ENSGGOP00000022829 XP_018880725.1.27298 ENSGGOP00000013820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]