SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013828 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000013828
Domain Number - Region: 40-121
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0955
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013828   Gene: ENSGGOG00000014175   Transcript: ENSGGOT00000014226
Sequence length 138
Comment pep:known_by_projection chromosome:gorGor3.1:10:13585540:13598137:-1 gene:ENSGGOG00000014175 transcript:ENSGGOT00000014226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWRQAVLLSCFSAVVLLSMLREGTSASVGTMQMAGEEASEDAKQKIFMQESDASNFLKR
RGKRSPKSRDEVNAENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWR
QWHYDGLHPSYLYNRHHT
Download sequence
Identical sequences G3RE54 H2Q1M4
ENSGGOP00000013828 XP_001140953.2.37143 XP_004049118.1.27298 ENSGGOP00000013828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]