SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013845 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013845
Domain Number 1 Region: 744-871
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.26e-27
Family Ankyrin repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 8-106
Classification Level Classification E-value
Superfamily BRCT domain 6.69e-19
Family BRCT domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013845   Gene: ENSGGOG00000014178   Transcript: ENSGGOT00000014244
Sequence length 1010
Comment pep:known_by_projection chromosome:gorGor3.1:5:77586915:77653522:1 gene:ENSGGOG00000014178 transcript:ENSGGOT00000014244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGTPKHIIQMTGFKMEEKEALVKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAA
CAAGKWILTKDYIIHSAKSGRWLDETTYEWGYKIEKDSRYSPQMQSAPKRWREELKRTGA
PGAFHRWKVVLLVRTDKRSDSLIRVLEAGKANVILPKSSPSGITHVIASNARIKAEKEKD
NFKAPFYPIQYLGDFLLEKEMQNHEDVNVGSILIQHHKKEKFSGSSKDLKFVKMRNTFGR
HTYENQKEIKKKDEDIQRSYTLRRKRKKEKEGNCKKDVEHEKIKSTLRRHIYNRDQKEMK
NSIFAEYAKESKAMAIKTDVDVVEIKNTLRKHIYRAQAVRYNCIRIDKQPVYNVEVKNAE
FPRGVLNLIESLIEGQFFKEAIEELSTLQAHYIPPVCVLHALLENVLQDNIDTFSGRYFH
ILSALLHLHPPWKSPAMSRYYLELFQCPTCMKGAWSLVEVLIRSCLFNESFCHQISENIG
SKVLHLTLLKFFFNLIESEVQHLSRKLYDWSDSQNLKITGKAMLLEIFWSGSETSGLLTK
PVNMLLEWTIYSHKEKFKSNDVFKHELAYLLAGILGAAIDYWIFLGLKMGRNVMRHMSDD
LGSYISLSCDDFSSQELEIFICSFSSSWLQMFVAEAVFKKLCLQSSGSVSSEPLSLQKMV
YSYLPALGKTGVLGSGKIQVSKKIGQRPCFDSQRALLMLNGTKQKQVEGLPELPDLNLAK
CSSSLKKLKKKSEGELSCSKENCPSVVKKMNFHKTNLKGETALHRACINNQVEKLILLLS
LPGIDINVKDNAGWTPLHEACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHV
EIGKLLLQHGGPVLLQQRNAKGELPLDYVVSPQIKEELFAITKIEDTVENFHAQAEKHFH
YQQLEFGSFLLSRMLLNFCSIFDLSSQFILASKGLTHLNELLMACKSHKETTSVHTDWLL
DLYAGNIKTLQKLPHILKELPENLKVCPGVHTEALMVTLEMMCRSVMEFS
Download sequence
Identical sequences ENSGGOP00000013845 XP_018881870.1.27298 ENSGGOP00000013845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]