SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013855 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013855
Domain Number 1 Region: 1822-1989
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.03e-16
Family 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013855
Domain Number - Region: 1537-1591
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000207
Family Formin homology 2 domain (FH2 domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013855   Gene: ENSGGOG00000014195   Transcript: ENSGGOT00000014255
Sequence length 2134
Comment pep:known_by_projection chromosome:gorGor3.1:14:56026070:56099884:1 gene:ENSGGOG00000014195 transcript:ENSGGOT00000014255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYPNWGRYGGSSHYPPPPVPPPPPVALPEASPGPGYSSSTTPAAPSSSGFMSFREQHLAQ
LQQLQQMHQKQMQCVLQPHHLPPPPXHWQPPPPPMPPPPGPALSYQKQQQYKHQMLHHQR
DGPPGLVPMELESPPESPPVPPGSYMPPSQSYMPPPQPPPSYYPPTSSQPYLPPAQPSPS
QSPPSQSYLAPTPSYSSSSSSSQSYLSHSQSYLPSSQASPSRPSQGHSKSQLLAPPPPSA
PPGNKTTVQQEPLESGAKNKSTEQQQAAPEPDPSTMTPQEQQQYWYRQHLLSLQQRTKVH
LPGHKKGPVVAKDTPEPVKEEVTVPATSQVPESPSSEEPPLPPPNEEVPPPLPPEEPQSE
DPEEDARLKQLQAAAAHWQQHQQHRVGFQYQGIMQKHTQLQQILQQYQQIIQPPPHIQTM
SVDMQLRHYEMQQQQFQHLYQEWEREFQLWEEQLHSYPHKDQLQEYEKQWKTWQGHMKAT
QSYLQEKVNSFQNMKNQYMGNMSMPPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALP
ATVPPPGMPPPVMPPSLPTSVPPPGMPPSLSPAGPPPVLPPPSLSSAGPPPVLPPPSLSS
TAPPPVMPLPPLSSATPPPGIPPPGVPQGIPPQLTAAPVPPASSSQSSQVPEKPRPALLP
TPVSFGSAPPTTYHPPLQSAGPSEQVNSKAPLSKSALPYSSFSSDQGLGESSAAPSQPIT
AVKDMPVRSGGLLPDPPRSSYLESPRGPRFDGPRRFEDLGSRCEGPRPKGPRFEGNRPDG
PRPRYEGHPAEGTKSKWGMIPRGPASQFYITPSTSLSPRQSGPQWKGPKPAFGQQHQQQP
KSQAEPLSGNKEPLADTSSNQQKNFKMQSAAFSIAADVKDVKAAQSNENLSDSQQEPPKS
EVSEGPVEPSNWDQNVQSMETQIDKAQAVTQPVPLANKPVPAQSTFPSKTGGMEGGTAVA
TSSLTADNDFKPVGIGLPHSENNQDKGLPRPDNRDNRLEGNRGNSSSYRGPGQSRMEDTR
DKGLVNRGRGQAISRGPGLVKQEDFREKMMGRREDSREKMNRGEGSRDRGLVRPGSSREK
VPGGLQGSQDRGAAGSRERGPPRRAGSQERGPLRRAGSRERVPPRRAGSRERGPPRGPGS
RERGLGRSDFGRDRGPFRPEPGDGGEKVYPYHRDEPPRAPWNHGEERGHEEFPLDGRNAP
MERERLDDWDRERYWRECERDYQDDTLELYNREDRFSAPPSRSHDGDRRGPWWDDWERDQ
DMDEDYNREMDRDMDRDVDRIGRPMDMYDRSLDNEWDRDYGRPLDEQESQFRERDIPSLP
PLPPLPPLPPLDRYRDDRWREERNREHGYDRDFRDRGELRIREYPERGDTWREKRDYVPD
RMDWERERLSDRWYPSDVDRHSPMAEHMPSSHHSSEMMGSDASLDSDQGLGGVMVLSQRQ
HEIILKAAQELKMLREQKEQLQKMKDFGSEPQMADHLPPQESRLQNTSSRPGMYPPPGSY
RPPPPMGKPPGSIVRPSAPPARSSVPVTRPPVPIPPPPPPPPLPPPPPVIKPQTSAVEQE
RWDEDSFYGLWDTNDEQGLNSEFKSETAAIPSAPVLPPPPVHSSIPPPGPVPMGMPPMSK
PPPVQQTVDYGHGRDISTNKVEQIPYGERITLRPDPLPERSTFETEHAGQRDRYDRERDR
EPYFDRQSNVIADHRDFKRDRETHRDRDRDRGVIDYDRDRFDRERRPRDDRAQSYRDKKD
HSSSRRGGFDRPSYDRKSDRPVYEGPSMFGGERRTYPEERMPLPAPSLSHQPPPAPRVEK
KPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVEFGGPAPRVLSLD
DYFITEVEKEEKDPDSGKKVKKKVMEYEYEAEMEETYRTSMFKTFKKTLDDGFFPFIILD
AINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEINKMADHWETAPR
HMMRLDIRSLLQDAAIEEVEMEDFDANIEEQKEEKKDAEEEESELGYIPKSKWEMDTSEA
KLDKLDGLRTGTKRKRDWEAIASRMEDYLQLPDDYDTRASEPGKKRVRWADLEEKKDADR
KRAIGFVVGQTDWEKITDESGHLAEKALNRTKYI
Download sequence
Identical sequences ENSGGOP00000013855 ENSGGOP00000024476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]