SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013860 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013860
Domain Number 1 Region: 27-544
Classification Level Classification E-value
Superfamily ARM repeat 1.63e-93
Family Clathrin adaptor core protein 0.0016
Further Details:      
 
Domain Number 2 Region: 602-762
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 6.8e-63
Family Coatomer appendage domain 0.0000000266
Further Details:      
 
Domain Number 3 Region: 763-873
Classification Level Classification E-value
Superfamily Subdomain of clathrin and coatomer appendage domain 5.1e-33
Family Coatomer appendage domain 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013860   Gene: ENSGGOG00000014201   Transcript: ENSGGOT00000014260
Sequence length 874
Comment pep:known_by_projection chromosome:gorGor3.1:3:129167308:129197052:1 gene:ENSGGOG00000014201 transcript:ENSGGOT00000014260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEH
LGTTEATEAFFAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNY
RGPAVRALCQITDSTMLQAIERYMKQAIVDKVPSVSSSALVSSLHLLKCSFDVVKRWVNE
AQEAASSDNIMVQYHALGLLYHVRKNDRLAVNKMISKVTRHGLKSPFAYCMMIRVASKQL
EEEDGSRDSPLFDFIESCLRNKHEMVVYEAASAIVNLPGCSAKELAPAVSVLQLFCSSPK
AALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGSESSIDRL
MKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEYKRAIVDC
IISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYIRFIYNRV
VLEHEEVRAGAVSALAKFGAQNEEMLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQK
ALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPLATAPMAEQRTESTPITAVK
QPEKVAATRQEIFQEQLAAVPEFRGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMV
FQFDCTNTLNDQTLENVTVQMEPTEAYEVLCYVPARSLPYNQPGTCYTLVALPKEDPTAV
ACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVG
DEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDI
LVRSRLLLLDTVTMQVTARSLEELPVDIILASVG
Download sequence
Identical sequences A0A096NC40 A0A2K5UZF6 A0A2K5ZRT1 A0A2K6K0G3 A0A2K6PGK0 G3RE83 H9FRE4 K7DE65 Q9Y678
ENSGGOP00000013860 ENSPANP00000010354 ENSP00000325002 ENSP00000325002 gi|11559929|ref|NP_057212.1| ENSGGOP00000013860 NYSGRC-11559929 9606.ENSP00000325002 NP_057212.1.87134 NP_057212.1.92137 XP_001141317.2.37143 XP_003829466.1.60992 XP_004036317.1.27298 XP_005571791.1.63531 XP_010353054.1.97406 XP_011857602.1.47321 XP_017740480.1.44346 ENSP00000325002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]