SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013861 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000013861
Domain Number - Region: 305-314
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 22-91
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 0.0628
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013861   Gene: ENSGGOG00000014210   Transcript: ENSGGOT00000014261
Sequence length 468
Comment pep:novel chromosome:gorGor3.1:1:14136:26386:-1 gene:ENSGGOG00000014210 transcript:ENSGGOT00000014261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPVRMQHSLAGQTYAVPLIQPDLRREEAVQQMADALQYLQKVSGDIFSRISQRVEQSQS
QVQAIGEKVSLAQAKIEKIKGSKKAIKVFSSAKYPAPERLQEYGSIFTGAQDPGLQRRSR
HRIQSKHRPLDKRALQRRLTDFPVCVSTKPEPEDDAEEGLGGLPSNISSVSSLLLFNTTE
NLYKKYVFLDPLAGAVTKTHVMLGAETEEKLFDAPLSISKREQLEQQVPENYFYVPDLGQ
VPEIDVPSYLPDLPGIANDLMYSVDLGPGIAPSAPGTIPELPTFHTEVAEPLKADLQDGV
LTAPPPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDSSSIASPSVQGAPREVVD
PSGGRATLLESIRQAGGIGKAKLRSVKERKLEKKKQKEQEQVRATSQGGDLMSDLFNKLV
MRRKGISGKGPGAGEGPGGAFARVSDSIPPLPPPQQPQAEEDEDDWES
Download sequence
Identical sequences ENSGGOP00000013861 ENSGGOP00000024607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]