SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013883 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013883
Domain Number 1 Region: 177-304
Classification Level Classification E-value
Superfamily HIT-like 3.71e-49
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.02
Further Details:      
 
Domain Number 2 Region: 3-117
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.2e-36
Family FHA domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013883   Gene: ENSGGOG00000014232   Transcript: ENSGGOT00000014283
Sequence length 305
Comment pep:known_by_projection chromosome:gorGor3.1:9:33602084:33632607:-1 gene:ENSGGOG00000014232 transcript:ENSGGOT00000014283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSNVNLSVSDFWRVMMRVCWLVRQDSRHQRIRLPHLEAVVIGRGPETKITDKKCSRQQVQ
LKAECNKGYVKVKQVGVNPTSIDSVVIGKDQEVKLQPGQVLHMVNELYPYIVEFEEEAKN
PGLETHRKRKRSGNSDSIERDAVQEAEAGTGLEPGGNPGQCSVPLKKGKDAPIKKESLGH
WSQGLKISMQDPKMQVYKDEQVVVIKDKYPKARYHWLVLPWTSISSLKAVTREHLELLKH
MHTVGEKVIVDFAGSSKLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEY
FLESQ
Download sequence
Identical sequences ENSGGOP00000019212 ENSGGOP00000013883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]