SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013949 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013949
Domain Number 1 Region: 22-299,381-475
Classification Level Classification E-value
Superfamily Sialidases 4.21e-100
Family Sialidases (neuraminidases) 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013949   Gene: ENSGGOG00000014302   Transcript: ENSGGOT00000014352
Sequence length 497
Comment pep:known_by_projection chromosome:gorGor3.1:2b:131326375:131333769:1 gene:ENSGGOG00000014302 transcript:ENSGGOT00000014352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSSAAFPRWPQSMGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPD
DSHAHRLVLRRGTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTIFLFFIAVLG
HTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQL
PSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWHRGGLVPNLRSGECQLAV
VDSGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPA
PSRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAGDPRGGQVPGGPFSRLQPRADGPRQP
GPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWT
EPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPAS
PEPPNLGDKPRGCCWPS
Download sequence
Identical sequences G3REG3
ENSGGOP00000013949 ENSGGOP00000013949 XP_018877183.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]