SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013956 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013956
Domain Number 1 Region: 14-148
Classification Level Classification E-value
Superfamily C-type lectin-like 6.3e-33
Family C-type lectin domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013956   Gene: ENSGGOG00000014313   Transcript: ENSGGOT00000014360
Sequence length 149
Comment pep:known_by_projection chromosome:gorGor3.1:12:9912388:9927319:-1 gene:ENSGGOG00000014313 transcript:ENSGGOT00000014360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTKHKKCFIIFGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSK
YNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGS
EGCAYLSDDGAATARCYTERKWICRKRIH
Download sequence
Identical sequences G3REG9
XP_004052731.1.27298 ENSGGOP00000013956 ENSGGOP00000013956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]